Gjenskape menneske i 3D fra DNA genom – Genefisering


Denne er trinn 1 av analysen “Gjenskape menneske i 3D fra DNA genom ved bruk av Fraktal egenskaper og Deep Learning” [3]

Go to Crypto Coin Sniper!

Vi trenger å dele opp DNA genomet i deler, da er det åpenbare å dele det opp i gener. Et kodeområde av et gen også kjent som CDS (coding sequence). En CDS har et start condon (AUG) og avsluttes med en stop condon (UAA,UGA,UAG) [1]

Tar vi vår meget kjente Bacteriophage T4 er det siste gen for T4 definert slik:

gene complement(167965..168903)
FT /gene=”rIIB”
FT CDS complement(167965..168903)
FT /codon_start=1
FT /transl_table=11
FT /gene=”rIIB”
FT /product=”rIIB protector from prophage-induced early lysis”
FT /note=”membrane integrity protector; mutants give rapid
FT lysis on various lysogenic strains due to effects of
FT specific prophage products, mistakenly interpreted as
FT related to lysis inhibition”
FT /db_xref=”GOA:P03691″
FT /db_xref=”InterPro:IPR036388″
FT /db_xref=”UniProtKB/Swiss-Prot:P03691″
FT /protein_id=”AAD42649.1″
FT /translation=”MYNIKCLTKNEQAEIVKLYSSGNYTQQELADWQGVSVDTIRRVLK
FT NAEEAKRPKVTISGDITVKVNSDAVIAPVAKSDIIWNASKKFISITVDGVTYNATPNTH
FT SNFQEILNLLVADKLEEAAQKINVRRAVEKYISGDVRIEGGSLFYQNIELRSGLVDRIL
FT DSMEKGENFEFYFPFLENLLENPSQKAVSRLFDFLVANDIEITEDGYFYAWKVVRSNYF
FT DCHSNTFDNSPGKVVKMPRTRVNDDDTQTCSRGLHVCSKSYIRHFGSSTSRVVKVKVHP
FT RDVVSIPIDYNDAKMRTCQYEVVEDVTEQFK”

Vi ser i DNA genomet at dette er 167965..168903 som vist nedenfor

xxxxxxxxxx xxxxxxxxxx xxxxxtcttc ttttactcgt gcttgataag ctaacataat 167940
tttccttagt taagggccga agccttattt aaattgttca gtaacgtctt caactacttc 168000
atattggcag gtacgcattt tagcatcgtt gtaatcaatc ggaattgata ctacatcgcg 168060
aggatgaact ttaactttta caactcggct ggttgaacta ccaaagtgac gaatataaga 168120
tttagaacac acatgcaaac cacgagaaca agtttgtgta tcatcgtcat tcacacgagt 168180
acgtggcatt ttaactactt tacccggact gttatcaaag gtgtttgagt gacagtcaaa 168240
gtaattgctg cgaactactt tccaagcata gaagtaacca tcttctgtaa tttcaatatc 168300
gtttgctacc aagaaatcaa agagtcgaga taccgctttt tggcttgggt tttccaacag 168360
attttccaag aacggaaaat aaaattcaaa gttttcgcct ttttccatcg agtcaagaat 168420
acgatcaacc aaaccagacc gcaattcaat attttgatag aacaagcttc caccttcaat 168480
tcgaacatcg ccggaaatat atttttcaac agcacgacga acattaattt tttgtgccgc 168540
ttcttccaac ttatccgcta caagcagatt aagaatttcc tggaagtttg aatgagtatt 168600
aggagttgcg ttataagtta cgccatcaac agtaattgaa atgaattttt tagatgcatt 168660
ccaaataatg tcagatttag caactggagc aataactgca tcgctattaa ctttaactgt 168720
aatatcaccg ctaatagtaa ctttagggcg tttagcttct tcagcatttt tcaaaacacg 168780
acggattgtg tcaaccgata caccttgcca atcagccaat tcctgttggg tgtaattacc 168840
acttgaatac agtttaacaa tttcagcttg ttcgtttttg gtcaggcatt taatattgta 168900
cat 168903

Genet definert som en DNA kjede vil se slik ut.

tcttcttttactcgtgcttgataagctaacataattttccttagttaagggccgaagccttatttaaattgttcagtaacgtcttcaactacttcatattggcaggtacgcattttagcatcgttgtaatcaatcggaattgatactacatcgcgaggatgaactttaacttttacaactcggctggttgaactaccaaagtgacgaatataagatttagaacacacatgcaaaccacgagaacaagtttgtgtatcatcgtcattcacacgagtacgtggcattttaactactttacccggactgttatcaaaggtgtttgagtgacagtcaaagtaattgctgcgaactactttccaagcatagaagtaaccatcttctgtaatttcaatatcgtttgctaccaagaaatcaaagagtcgagataccgctttttggcttgggttttccaacagattttccaagaacggaaaataaaattcaaagttttcgcctttttccatcgagtcaagaatacgatcaaccaaaccagaccgcaattcaatattttgatagaacaagcttccaccttcaattcgaacatcgccggaaatatatttttcaacagcacgacgaacattaattttttgtgccgcttcttccaacttatccgctacaagcagattaagaatttcctggaagtttgaatgagtattaggagttgcgttataagttacgccatcaacagtaattgaaatgaattttttagatgcattccaaataatgtcagatttagcaactggagcaataactgcatcgctattaactttaactgtaatatcaccgctaatagtaactttagggcgtttagcttcttcagcatttttcaaaacacgacggattgtgtcaaccgatacaccttgccaatcagccaattcctgttgggtgtaattaccacttgaatacagtttaacaatttcagcttgttcgtttttggtcaggcatttaatattgtacat

Fra dette kan vi videre f.eks. først “vaske” og analysere om det er noen “koder” som gjentar seg. Slik at man kan “pakke” DNA kjeden til vi har en kortere kjede.

[1] https://en.wikipedia.org/wiki/Coding_region
[2] https://www.ebi.ac.uk/ena/data/view/AF158101&display=text
[3] https://torandersengen.net/v2/3d-dna-deep-learning/

Bilde : https://en.wikipedia.org/wiki/Enterobacteria_phage_T4#/media/File:Tevenphage.svg

Vennligst registrer deg for nyheter!

Nå abonnert du på mine nye artikler. Tusen takk!

Det oppstod en feil under din registrering. Vær så snill, prøv på nytt.